HORDB

ID: hor006521
Uniprot ID: P01181
Protein name: Copeptin
Gene name: AVP
Organism: Ovis aries (Sheep)
Family: Vasopressin/oxytocin family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Ovis (genus), Caprinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005185 neurohypophyseal hormone activity
GO BP: GO:0007165 signal transduction; GO:0042310 vasoconstriction; GO:0097746 blood vessel diameter maintenance
GO CC: GO:0005576 extracellular region

Sequence: ASDRSNATLLDGPSGALLLRLVQLAAAPEPAEPAQPGVY
Length: 39
Propeptide: CYFQNCPRGXXXAMSDLELRQCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCQEEIYLPSPCQSGQKPCGSGGRCAAAGICCNDESCVTEPECREGIGFPRRVXASDRSNATLLDGPSGALLLRLVQLAAAPEPAEPAQPGVY
Signal peptide: NA
Modification: NA
Glycosylation: T6 N-linked (GlcNAc...) asparagine
Mutagenesis: NA

Function: Neurophysin 2 specifically binds vasopressin.; Vasopressin has a direct antidiuretic action on the kidney, it also causes vasoconstriction of the peripheral vessels. Acts by binding to vasopressin receptors (V1bR/AVPR1B, V1aR/AVPR1A, and V2R/AVPR2) (By similarity).
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006521_AF2.pdb

hor006521_ESM.pdb

Mass:	460844	Formula:	C173H282N48O56
Absent amino acids:	CFHIKMW	Common amino acids:	A
pI:	4.11	Basic residues:	2
Polar residues:	9	Hydrophobic residues:	17
Hydrophobicity:	5.9	Boman Index:	-3171
Half-Life:	4.4 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	105.38
Instability Index:	5893.08	Extinction Coefficient cystines:	1490
Absorbance 280nm:	39.21